PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.2NG525400.3.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family GRAS
Protein Properties Length: 570aa    MW: 64442.1 Da    PI: 6.5189
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.2NG525400.3.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS419.72.5e-1281995682373
                 GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPil 91 
                          ++lL++cAea+s++   +  +l+++ +  +s +g+p+qRl ay++e+L ar  +s++++y+al+++e +   s e l+++k+++ ++P++
  Pavir.2NG525400.3.p 199 KQLLTKCAEALSEERIDEFLKLVQQARGVVSITGEPIQRLGAYLLEGLVARHGNSGTNIYRALKCREPE---SNELLSYMKILYSICPYF 285
                          689*****************************************************************9...99**************** PP

                 GRAS  92 kfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefn 179
                          kf++++aN aI ea+ +e+++HiiDf+i qG+QW++L+qaLa+Rp+gpp++RiTg+++p s+  + e l  +g+ L+++ ee+++p+ef+
  Pavir.2NG525400.3.p 286 KFGYMAANGAIAEALRNEDKIHIIDFQIAQGTQWITLIQALAARPGGPPHVRITGIDDPVSEyaRGEGLDLVGKMLKSMSEEFRIPLEFT 375
                          ***********************************************************999999************************* PP

                 GRAS 180 vlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfd 269
                          +l     + ++ e+L+++pgEalaVn+ lqlh+++desv+++++rd +L++vk+lsPkv ++veqe+ +n+++Fl rf+e+++yysa+f+
  Pavir.2NG525400.3.p 376 PLPGVYATRVTKEMLDIRPGEALAVNFTLQLHHTPDESVDVNNPRDGLLRMVKGLSPKVTTLVEQESHTNTTPFLMRFSETMDYYSAMFE 465
                          *98889999********************************************************************************* PP

                 GRAS 270 sleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslv 359
                          s++++lpr+s+eri+vE+++l+++ivn++aceg++r+erhe l+kW++rl++aGFkp++ls+++++ ++ ll+ ++ d y++ee++g+++
  Pavir.2NG525400.3.p 466 SIDTNLPRDSKERINVEQHCLAKDIVNIIACEGKDRVERHELLGKWKSRLTMAGFKPYSLSSYVNSVIRKLLACYS-DKYTLEEKDGAML 554
                          ************************************************************************9999.55*********** PP

                 GRAS 360 lgWkdrpLvsvSaW 373
                          lgWk+r+L+s+SaW
  Pavir.2NG525400.3.p 555 LGWKNRKLISASAW 568
                          ************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098564.722172550IPR005202Transcription factor GRAS
PfamPF035148.6E-126199568IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 570 aa     Download sequence    Send to blast
MDLHQVLKYR LTGANIFYEF PTENNLANTP WPATPLKSEF SNSPYTPLSA QLECDNLSAI  60
SNTPDNQSST ETISAQPISP LEVDSSYRQS GILRENTQVR PDQLYTTSRH NMQHALREIE  120
TVLMAPDADD AANSTKHEFE EHKPTQLMRQ RSRTWSESRQ PSPGIVRTQF GSGYPTASYD  180
FRPEKRQREL REDPQSMVKQ LLTKCAEALS EERIDEFLKL VQQARGVVSI TGEPIQRLGA  240
YLLEGLVARH GNSGTNIYRA LKCREPESNE LLSYMKILYS ICPYFKFGYM AANGAIAEAL  300
RNEDKIHIID FQIAQGTQWI TLIQALAARP GGPPHVRITG IDDPVSEYAR GEGLDLVGKM  360
LKSMSEEFRI PLEFTPLPGV YATRVTKEML DIRPGEALAV NFTLQLHHTP DESVDVNNPR  420
DGLLRMVKGL SPKVTTLVEQ ESHTNTTPFL MRFSETMDYY SAMFESIDTN LPRDSKERIN  480
VEQHCLAKDI VNIIACEGKD RVERHELLGK WKSRLTMAGF KPYSLSSYVN SVIRKLLACY  540
SDKYTLEEKD GAMLLGWKNR KLISASAWH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-5822156926375GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.64580.0callus| leaf| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7278600.0KJ727860.1 Zea mays clone pUT5952 GRAS transcription factor (GRAS49) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004957943.10.0PREDICTED: chitin-inducible gibberellin-responsive protein 1
SwissprotQ69VG10.0CIGR1_ORYSJ; Chitin-inducible gibberellin-responsive protein 1
TrEMBLC5XAU20.0C5XAU2_SORBI; Putative uncharacterized protein Sb02g035680
STRINGSb02g035680.10.0(Sorghum bicolor)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48150.21e-180GRAS family protein